PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000123919
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TCP
Protein Properties Length: 348aa    MW: 35970.2 Da    PI: 7.5625
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000123919genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP106.15.5e-33701331073
            TCP  10 kihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                    ++hTkv+gR+RRvR++a+caar+F+L++eLG+++d++ti WLl+ ++pai+++tg+++++a ++
  MDP0000123919  70 DRHTKVEGRGRRVRMPATCAARIFQLTRELGHKSDGETIRWLLEHSEPAIIQATGSGTIPAIAV 133
                    8*******************************************************99998444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136925.8468122IPR017887Transcription factor TCP subgroup
PfamPF036343.1E-2770134IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MKSNQRQSLQ ESNELERGGD SNNTSTSGSS PSVANTPEQN FSATVLMMKE ELAGPVQQLD  60
QQGSLSMGID RHTKVEGRGR RVRMPATCAA RIFQLTRELG HKSDGETIRW LLEHSEPAII  120
QATGSGTIPA IAVSVGGALK IPTTSPARPN GEGTEIPKKR KKMRGSLGEF ADVHDQSSGL  180
APIAPMIYGG GGGGLVPMWQ IGATGAAGPF FMFPNSGTIQ NQPQLWAIPT ADSTAPIFNF  240
QPRPLSNFVS AFPAGVQVGS VGGGDGQLQA SSCSIPGGAA TGGGGSCSSS LGHSLESASG  300
TSAAASAAAA PRSATTQMLK DFSLEVYDKR ELQLMGQAAN SQTPRSES
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157161KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009341292.10.0PREDICTED: transcription factor TCP19-like
RefseqXP_009341290.10.0PREDICTED: transcription factor TCP19-like
TrEMBLW9RV441e-104W9RV44_9R
STRINGGLYMA20G29330.23e-90(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21183086
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.22e-56TCP family protein